SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000538 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000538
Domain Number 1 Region: 19-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.51e-65
Family Ankyrin repeat 0.0000231
Further Details:      
 
Domain Number 2 Region: 334-428
Classification Level Classification E-value
Superfamily DEATH domain 2.75e-16
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000538   Gene: ENSMPUG00000000544   Transcript: ENSMPUT00000000550
Sequence length 443
Comment pep:novel scaffold:MusPutFur1.0:GL896964.1:4753649:4794848:-1 gene:ENSMPUG00000000544 transcript:ENSMPUT00000000550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPLAWETDGLLPMERQLHEAARRNNIGRMKELMERRVNIRARNHVGRVALHWAAGAGH
EPAVRLLLEHKAAVDDEDAFGMNALLLSAWFGHLQILQILVNSGAKIHCENKDGLTLLHC
AAQKGHMPVLAFIMEDLEDVPLDHADKLGRTAFHRAAEHGQLDALDFLVGSGCDHSVKDK
KKQSCLHYAVLGGSEDMARTLIHAGGHTNMADHQGVSPLHLAVKHNFPALVQLLLDAGSD
LDAIDNRQQTPLHLAAEHARQDIAEMLLIAGVNLNLRDKQGKTALAVAARSNHVSLVDMI
IKADRLYTWEKDHPLRKDPKDPYRKNLTFKQDHLQERQQFHSVLWRLASRDLRPHEWKKL
AYCWEFTEAHVHAIEQQWTGSKSYQEHGHRMLLIWLHGVATAGENPGKALFEGLVAIGRR
NLAESIRKKANADLGTPSRCTAM
Download sequence
Identical sequences M3XN88
ENSMPUP00000000538 ENSMPUP00000000538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]