SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000558 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000558
Domain Number 1 Region: 357-492,528-533,701-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.06e-39
Family Tandem AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 2 Region: 117-204
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000895
Family Caspase recruitment domain, CARD 0.037
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000558
Domain Number - Region: 897-994
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.043
Family RNA-polymerase beta-prime 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000558   Gene: ENSMPUG00000000564   Transcript: ENSMPUT00000000570
Sequence length 1027
Comment pep:known scaffold:MusPutFur1.0:GL896909.1:15569361:15627285:-1 gene:ENSMPUG00000000564 transcript:ENSMPUT00000000570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSNGYSADKSFCYLISCFRARVKTYIQVEPVLDYLDFLPNDVKEQIQRTAVNAGNMQAA
DELLNALEKGGWPPGWPRQFLVALQRAGSVLAARYLNPELTDLPSPSSENAHDECLQLLN
LLQPTLVNRLLVRDVLDKCVEKKLLTNEDRNRISAAENNGNESGVRELLKRIVQKENWFS
EFLAALSETENHALVQELTGTPDFESNAETENLSQECGPDIQEAVLLATGPPSPEGAGWD
EDNDSPDSSLVDSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAER
ASPEPELNLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKEHLDKKKKASEPGKV
IVLVNKVPLVEQLFRKEFEPFLKKWYHTIGLSGDTQLKISFPEVVKTYDVIISTAQILEN
SLSNSEKGEDDGVQFSDFSLIVIDECHHTNKEAVYNNIMRRYLKQKLKNNKLKKECKPVI
PLPQILGLTASPGVGGAKRQAEAKDHILKICANLDACTIKTVKENIHQLKDQIKEPCKKF
AIADDTREDPFKDKLLEIMNKIQSFCQMSPMPDFGTQPYEQWTTQMEKKAAREGNRKERV
CAEHLRKYNEALQINDTIRTIDAYNHLEAFYNDEKEKKYAVQEDESDESGEDGDGGGDED
EVDEKKPLSLDKTDRFLMDLFFENRRMLKKLAENPKHENEKLTKLRNTIMEQYTRTEESA
RGIIFTKTRQSAYALSQWITENKKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFR
TGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSNSG
VIEREIVNDFREKMMYKAIDHVQNMNPEEYARKILELQMQSIMEKKMKIKRSIAKCYKEN
PSLINFLCKNCGELACSGEDIHVIEKMHHVNMTPVFKELYTVRENKALQKKFVDYQTNGE
IICKTCGQAWGTMMVHKGLDLPCLKIKNFVVVFKNNMLKKQYKKWVELPITFPDLDYTQY
CLFSDED
Download sequence
Identical sequences M3XNA8
ENSMPUP00000000558 ENSMPUP00000000558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]