SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000647 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000647
Domain Number 1 Region: 320-369
Classification Level Classification E-value
Superfamily UBA-like 2.3e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 44-101
Classification Level Classification E-value
Superfamily RING/U-box 4.47e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 1-29
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000026
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000647   Gene: ENSMPUG00000000653   Transcript: ENSMPUT00000000659
Sequence length 371
Comment pep:novel scaffold:MusPutFur1.0:GL896966.1:995556:1008000:-1 gene:ENSMPUG00000000653 transcript:ENSMPUT00000000659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEDGDLVAFSSDEELTMALSYVKDDIFRIYIKEKKECRRDHRPPCAQEMPRGLVHPNVIC
DGCNGPVVGTRYKCSVCPDYDLCAACEGKGLHREHSKLVLPAAFGPLPEGFSHSRWLRKL
KHGYFGWPGWEMGPPGNWSPRPPRAGDARPSSVAEPAEAAGPSEDPSVNFLKNVGESVAA
ALSPLGIEVDIDVEHGGKRSRLTPVSPGSSSTEEKCGSQPSSCSSDPSKPDGDPEGVAQS
LAEQMDKVALESGLPEEQMESDNCSGGDEDWTHLSSKEVDPSTGELQSLQMPESEGPGSL
DSSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAA
LDTIQYSKHPL
Download sequence
Identical sequences M3XNJ7
ENSMPUP00000000647 ENSMPUP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]