SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000698 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000698
Domain Number 1 Region: 85-287
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.13e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 379-434
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 794-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 727-794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000549
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 675-732
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000698   Gene: ENSMPUG00000000699   Transcript: ENSMPUT00000000710
Sequence length 1030
Comment pep:novel scaffold:MusPutFur1.0:GL896966.1:1418146:1630507:1 gene:ENSMPUG00000000699 transcript:ENSMPUT00000000710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEEFFIEPLEKGLAAKEAEQGRVHVVYRRPPTPRPPPLGGPQALDTGAPPGSLDNLSR
ALGVLEEHINGSRHRARRHATDGDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEI
YHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHD
HAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQ
GNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLRDDPFAHDWPALPQL
PGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAP
GKHCFKGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCS
GLAYDFQLCNSQECPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCES
RETGEVVSMKRMVHDGTRCSYKDAFSLCVRGECRKVGCDGVIGSSKQEDKCGVCGGDNTH
CKVVKGTFTRSPKKLGYIKMFEIPAGARHLLIQEADSTSHHLSVKNLETGKFILNEENDV
DPNSKSFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPQGDARISLTYKYMIHEDSL
NVDGNNVLEDDSVGYEWALKKWTPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCDALTKP
KAIRRACNPQECSQPVWVTGEWEPCSQSCGRMGTQARSVRCVQPLHNNTTRSVHTKHCND
ARPEGRRACNRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTADDSFGICREERPETAR
ICRLGPCPRNISDPSKKSYVVQWLSRPDPDSPVQKTSSKGRCQGDKSMFCRMEVLSRYCS
IPGYQKLCCQSCNLHDNLTEVDNKAEPPPRKLNDIEEFMPTLPVPTLVMEVHPVPGTPPQ
APLNASSTNSTEDHPDTNAVDMPYKIGGLDEEVQPPNLIPRRPSPYEKTRNQRIQELIDE
MRKKEMLGKF
Download sequence
Identical sequences M3XNP8
ENSMPUP00000000698 ENSMPUP00000000698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]