SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000777 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000777
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-73
Family Cyclophilin (peptidylprolyl isomerase) 0.000000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000777   Gene: ENSMPUG00000000779   Transcript: ENSMPUT00000000791
Sequence length 753
Comment pep:known scaffold:MusPutFur1.0:GL896909.1:22387061:22443878:1 gene:ENSMPUG00000000779 transcript:ENSMPUT00000000791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKAKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDTSDSESASEEKSKKRKKKHRKNSRK
HKKEKKKRKKSKKSASSESETENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
NRERERDRECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPP
HWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRIKEKKVTDHRHVSESPNRKN
EKEKKVKDHKSNSKERDIRRNSEKDEKYNKNKVKKRAKSKSRSKSKEKSKSKERDTKHNR
HEEKRVRSRSKERDHEIVKEKEKSDSKGKDQERSRSKEKSKQLESKSNEHDHNKSKEKDR
RAQSRSRERDITKGKHSYNSRTRERSRSRDRSRRVRSRSHDRDRSRSKEYHRYREQEYRR
RGRSRSRERRATPGRSRSKDRRRRRRDSRSSEREESQSRNKEKYRNQESKSSHRKENSEG
EKRMYSKNRDHNSSNNREKKSDRDQSPFSKIKQSSQDNELKFSTLKNKEDEKTRSSVEKE
NQKSKGQENDHIHDKNKKFDHESSPGTDEDKSG
Download sequence
Identical sequences M3XNX7
ENSMPUP00000000777 XP_004744084.1.14098 XP_004744087.1.14098 XP_004744089.1.14098 XP_004744090.1.14098 XP_012907501.1.14098 XP_012907502.1.14098 XP_012907503.1.14098 ENSMPUP00000000777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]