SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000801 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000801
Domain Number 1 Region: 142-287
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.67e-18
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000801   Gene: ENSMPUG00000000804   Transcript: ENSMPUT00000000816
Sequence length 330
Comment pep:novel scaffold:MusPutFur1.0:GL896964.1:9650207:9677335:1 gene:ENSMPUG00000000804 transcript:ENSMPUT00000000816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVELKEEWQDEDFPIPLPEDDSMEADVLAVSGPENQPEVNGNKVRKKLMAPDISLTLD
PSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTTAEE
KEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESGQPNY
RYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKS
LIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQYEEEK
FKKKQKRVDQELNGKQDEPKSEQNHKRLLG
Download sequence
Identical sequences M3XP01
ENSMPUP00000000801 ENSMPUP00000000801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]