SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000873 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000873
Domain Number 1 Region: 233-353
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 462-589
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-28
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 127-237
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-25
Family Cadherin 0.0032
Further Details:      
 
Domain Number 4 Region: 578-683
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 347-466
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-19
Family Cadherin 0.0051
Further Details:      
 
Domain Number 6 Region: 26-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000628
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000873   Gene: ENSMPUG00000000877   Transcript: ENSMPUT00000000889
Sequence length 732
Comment pep:known scaffold:MusPutFur1.0:GL897150.1:35565:37802:-1 gene:ENSMPUG00000000877 transcript:ENSMPUT00000000889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVRLLLPPPHRSGMYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGKDARLQPG
LPPADYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMI
KVEIQDINDNAPSFPSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGL
FALDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGDPPRSATVQINVKVIDSND
NSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDP
KTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQ
GALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENY
DNFYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAVKILDENDNPPRFTKGLYV
LQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALR
SFNYEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVP
RNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPV
VELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISII
LLAAMITIAVKC
Download sequence
Identical sequences M3XP73
ENSMPUP00000000873 ENSMPUP00000000873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]