SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000945 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000945
Domain Number 1 Region: 91-382
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.73e-85
Family PhyH-like 0.000000000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000945   Gene: ENSMPUG00000000952   Transcript: ENSMPUT00000000964
Sequence length 385
Comment pep:novel scaffold:MusPutFur1.0:GL897101.1:1963902:1981247:1 gene:ENSMPUG00000000952 transcript:ENSMPUT00000000964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPVHPRTRRNSRSSERSARPFGSAPRPPPRGKTEVRLTRLLEGAMNQSHAGTRLRVVLGH
LGQRSAGVGVSFAVRVARAAIILICNSFFSFRYTRDNNVLSLEQRKFYEENGFLVIRNLV
SDADIERFRNEFERICKGEVKPQGMMIMRDVSIAKSEFTPGEKMISKIQDFQEDEELFRY
CTLPEILKYVECFTGPDIMALHTMLINKPPDTGKKTSRHPLHQDLHYFPIRPSNNIVGAW
TAMEHIDRNNGCLCVLPGSHKGDLKPHAYPRWLGGGVNIMFYGIQDYDKNCPRVHLVMEK
GDTVFFHPLLIHGSGWNRTQGYRKAISCHFAGADCHYIDVKGTSQEITERDYLPIGKKLY
GFPDDTRLQDVLRFQVRLVKGKRIN
Download sequence
Identical sequences M3XPE5
ENSMPUP00000000945 ENSMPUP00000000945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]