SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001011 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001011
Domain Number 1 Region: 266-475
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.54e-54
Family Reprolysin-like 0.00076
Further Details:      
 
Domain Number 2 Region: 568-622
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 875-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001011   Gene: ENSMPUG00000001019   Transcript: ENSMPUT00000001032
Sequence length 931
Comment pep:novel scaffold:MusPutFur1.0:GL896955.1:2968132:3008988:-1 gene:ENSMPUG00000001019 transcript:ENSMPUT00000001032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGWASLLLCALRLPLVAVGPAAAPAQDKAGQPWAAAEAAQPRRRQGEEAQERAEPPGH
PHPLAPPQRRSSGLVQNIDQIYSGGGKVGYLVYAGGRRFLLDLERDGSVGAAGFVPAGSG
LSATRHHRDHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEAEAG
RVYGVGSSRILHVYTREGFSFEALPPRTSCETPGSPPGPRERPPAHSSPDRRWALAPQFL
DQSAPSSDGAQEPQTWWRRRRRSISRARQVELLLVADASMARMYGRGLQHYLLTLASIAN
RLYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHY
DAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLS
HDDSKFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQ
ILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEG
TPCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAP
RNSGRYCTGKRAIYRSCNVMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGV
LLGDVCKLTCRAKGTGYYVVFSPKVTDGTECRPYSNSVCVRGKCVRTGCDGIIGSKLQYD
KCAVCGGDNSSCTKVIGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKK
KNGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDP
TKALDVRYSFFVPKKSTQKVNSVTSHGSNKVGSPTPQLQWVTGPWLACSRTCDTGWHTRT
VQCQDANRKLAKGCLLSQRPSAFKQCLLKKC
Download sequence
Identical sequences M3XPL1
ENSMPUP00000001011 ENSMPUP00000001011 XP_004757506.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]