SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001018 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001018
Domain Number 1 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000118
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number 2 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000124
Family DEATH domain, DD 0.036
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000262
Family TNF receptor-like 0.0024
Further Details:      
 
Domain Number 4 Region: 293-371
Classification Level Classification E-value
Superfamily DEATH domain 0.000000277
Family DEATH domain, DD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001018   Gene: ENSMPUG00000001026   Transcript: ENSMPUT00000001039
Sequence length 401
Comment pep:known scaffold:MusPutFur1.0:GL896908.1:7430404:7458064:-1 gene:ENSMPUG00000001026 transcript:ENSMPUT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLLCCALVFLDISIKWTTQETFPPKYLHYDPETSRQLMCDKCPPGTSLKQHCTARRKT
VCAPCPNHYYTDRWHTSDECLYCTPVCKELQYIKQECNRTHNRVCECEEGRYLEVEFCLK
HRSCPPGFGVLHAGTPERNTVCRRCPDGFFSNETSSKAPCRKHTDCSAFGLLLIQKGNAT
HDNVCSANSEPTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSILVDNLPGTRVNAESVEKI
KRQHSSQEQTFQLLKLWKHQNKDQDMVKKIFQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVPAEDIEKTLKACKSSEQILKLLSLWRIKNGDQDTLKALMHALKHLKTYHFPKA
VTQSLKKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences M3XPL8
ENSMPUP00000001018 XP_004743539.1.14098 ENSMPUP00000001018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]