SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001076 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001076
Domain Number 1 Region: 14-74
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000839
Family B-box zinc-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001076   Gene: ENSMPUG00000001086   Transcript: ENSMPUT00000001099
Sequence length 115
Comment pep:novel scaffold:MusPutFur1.0:GL897255.1:38282:38907:-1 gene:ENSMPUG00000001086 transcript:ENSMPUT00000001099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKLRSQLQHQIPEDAYCGEHQQPLQLFCDDDQMLLCGQCFHPEGHESHVVFGVQEAAG
RYRELFQEILNTLKEKLEVAKSILADEQERMVMIQVSAYLQPEQAITYNVGSRKA
Download sequence
Identical sequences M3XPS6
ENSMPUP00000001076 ENSMPUP00000001076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]