SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001174 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001174
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.28e-19
Family EB1 dimerisation domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001174   Gene: ENSMPUG00000001185   Transcript: ENSMPUT00000001199
Sequence length 326
Comment pep:known scaffold:MusPutFur1.0:GL896931.1:12929444:13028171:-1 gene:ENSMPUG00000001185 transcript:ENSMPUT00000001199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSSSASKSDKDLE
TQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASE
EHEGHPEEAEAEDQVHDQQPQQQEEY
Download sequence
Identical sequences M3XQ24
XP_004752364.2.14098 ENSMPUP00000001174 ENSMPUP00000001174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]