SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001188 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001188
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.32e-18
Family FHA domain 0.0016
Further Details:      
 
Domain Number 2 Region: 274-339
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000709
Family PHD domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001188   Gene: ENSMPUG00000001200   Transcript: ENSMPUT00000001214
Sequence length 343
Comment pep:known scaffold:MusPutFur1.0:GL897448.1:116854:121399:1 gene:ENSMPUG00000001200 transcript:ENSMPUT00000001214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCFQLLRIGGGRGGDLYTFHPSGAGCTYRLGRRADLCDVPLQPQQEPSLISGVHAELH
AERRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLVTFGPEGPPGTSPSEFYFMF
QQVRVKPQDFAAITIPRSSEEGTKAGFWPMLPPQGAPQRPLSTLSPAPKATLILNSIGSL
SKLRPLPLTFSRSGGEPQSLPIPTPPREVGTTPSAPPPRNRRKSAHRVLAELDDEGETPE
GPPPVFMEPRKKLRVETTPQTPGGNRRGRPRKHPVRSPRAPPADGSGEPCAAPCCYLPEE
QTVAWVQCDGCDLWFHVACVGYSIQAAREADFRCPGCRIGIQT
Download sequence
Identical sequences M3XQ38
XP_004782354.1.14098 ENSMPUP00000001188 ENSMPUP00000001188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]