SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001202 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001202
Domain Number 1 Region: 406-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-56
Family SPRY domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 91-176
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 195-251
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000113
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001202
Domain Number - Region: 268-339
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 0.0379
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001202   Gene: ENSMPUG00000001212   Transcript: ENSMPUT00000001228
Sequence length 577
Comment pep:novel scaffold:MusPutFur1.0:GL897239.1:240208:250998:1 gene:ENSMPUG00000001212 transcript:ENSMPUT00000001228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWPAHRALASVSLPGRASSQLRSPPVRLQPRPSSPSGCSEAGPGQPTRNRVLSGPSTSP
APPGSGTPRERMAAVGPRTDPGAGAEALALAAELQGETTCSICLEMFREPVSVECGHSFC
RSCIARCWERPAVGAPAASRPLPGPLPCPQCREPVRPGQLRPNRQLASVTTLLRRFSLPA
AAPGERGPAQAAAAGCVQHGEPLKLYCQDDGRAICVVCDRAREHRAHAVLPLDEAVQEAK
ELLESRLKVLKKDLEDYEVFRSTEEKESKELLKQMAAEREKVSAEFQALRAFLVEQEGRL
LGRLEELSREVTQKQNENIAQLGGEITHLSKLSSQIQETSRKPDLDFLQEFRNTLRRCNN
VPGPKPTTVSSEMKNKVWNVSLKTFVLKGLLKKFKEDLRGELEKEEKVELTLDPDTANPR
LILSLDLKSVRLGQRAQDVPCHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVA
RESVRRKGLTPFTPEEGVWALQLNSGKYWAVTSPERTPLSCGQLSRVRVALDLEVGAVSF
YAAEDMRHLYTFRVNFHERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences M3XQ52
ENSMPUP00000001202 XP_004780268.1.14098 ENSMPUP00000001202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]