SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001268 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001268
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-38
Family SCAN domain 0.0000465
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001268
Domain Number - Region: 531-559
Classification Level Classification E-value
Superfamily Ctag/Cox11 0.0366
Family Ctag/Cox11 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001268   Gene: ENSMPUG00000001279   Transcript: ENSMPUT00000001295
Sequence length 804
Comment pep:novel scaffold:MusPutFur1.0:GL897227.1:748485:767703:-1 gene:ENSMPUG00000001279 transcript:ENSMPUT00000001295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEALPGLTPENGDSLVKVEEEDPPWEQTWGSRESSRHAQELCRLRFRQFCYRETPGPRE
ALSRLRELCRRWLRPETHSKEQIVELLVLEQFLTILPEELQAWVREQQPESGEQAVAALE
DLEKDTGDPGQQACVCTQGQDMYPLVSEYQGASLESQSLQLLPRVTGLKCEPPELYQKNP
QEGQMALPLGSIIYVEVSQRSGAVRPPALPQTSVKTEEEATQALVTEQWPPLSQIPGSPH
GKSAQEKVPDVCLMAEEVVTEDGLFNAKTETSQETEHAAEAPGTASRDGMPQPPCTSVPA
DRTVAHLNTLKDRYPGDLWARMHISSLEYAAGDMTRKGRRKDRARVSELLQGLAFSGDSD
VEEDNKLEAHHAQKKLKMSDVPEKNWTKRDIKPNFPSWSVLDSGLLNLKSEKLNPVELFE
LFFDDEIFNMIVNETNNYASQKNVSLDVTVPEIRCVLGILLLSGFVRRPRRGMYWDISDA
DQNLVRDAIRRDRFELIFSYLHFADNSHLDQKDKFTKLRPLIKQMNRNFLLYAPLEEYYY
FGKTMCECFDSDQFLNGKPLRIGYKIWCGTTTQGYLVWFEPYQEDSAVMVGKDVDLGLGG
NLVLHFADVLLERGQYPYHLFFDSFFTSIKLVSALKKKGLRATGTIRENRTEKCPLMNAE
HMRKMKKGYFDFRVEENEEIILCRWHGDGIISLCSNAVGIAPAREFRGSTNEEDVHQGAQ
PALVKLYGECREGVAKMDQIISKYRVRIRSKKWYSILVSYIIDVAMNNAWQLHRACNPGT
ALDLLEFRRYVAHFYLEHNANPSD
Download sequence
Identical sequences M3XQB8
ENSMPUP00000001268 ENSMPUP00000001268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]