SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001285 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001285
Domain Number 1 Region: 194-316
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 3.14e-59
Family USP8 interacting domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-21
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 78-142
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000118
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001285
Domain Number - Region: 140-193
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0876
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001285   Gene: ENSMPUG00000001296   Transcript: ENSMPUT00000001312
Sequence length 317
Comment pep:known scaffold:MusPutFur1.0:GL897076.1:716387:746195:-1 gene:ENSMPUG00000001296 transcript:ENSMPUT00000001312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
Download sequence
Identical sequences A0A024RB33 A0A0D9QYS9 A0A1U7T917 A0A2I3MFA3 A0A2J8UHP9 A0A2K5EI81 A0A2K5HTK7 A0A2K5KUH1 A0A2K5ZNP8 A0A2K6BF72 A0A2K6EH63 A0A2K6M0T0 A0A2K6PU91 A0A2K6S0E5 E2QVC5 F6RSF7 F7ACG1 G1RJI8 G3R697 G7PIG9 H0WIS7 H2Q681 I3M2E9 M3WYQ0 M3XQD5 Q5R7T5 Q99MS2 Q9H4P4 U3ENC8
ENSMPUP00000001285 ENSSTOP00000003148 NP_001126274.1.23681 NP_001181577.1.72884 NP_001229755.1.87134 NP_001229755.1.92137 NP_005776.1.87134 NP_005776.1.92137 NP_919340.1.87134 NP_919340.1.92137 XP_001169244.1.37143 XP_003282629.1.23891 XP_003790567.1.62490 XP_003790568.1.62490 XP_003824974.1.60992 XP_003824975.1.60992 XP_003939368.1.74449 XP_003988932.1.62641 XP_004053409.1.27298 XP_004053410.1.27298 XP_004401722.1.74151 XP_004401723.1.74151 XP_004429297.1.5094 XP_004601662.1.94378 XP_004773164.1.14098 XP_004773165.1.14098 XP_005335683.1.77405 XP_005371245.1.66349 XP_005571267.1.63531 XP_005571270.1.63531 XP_005611357.1.31192 XP_005625547.1.84170 XP_005625548.1.84170 XP_006218634.1.17985 XP_006751900.1.47382 XP_006859489.1.41390 XP_006933870.1.62641 XP_006933871.1.62641 XP_008052873.1.4292 XP_008528363.1.77740 XP_008976857.1.60992 XP_009002219.1.60252 XP_009002220.1.60252 XP_009002221.1.60252 XP_009002223.1.60252 XP_009246169.1.23681 XP_009246170.1.23681 XP_009423416.1.37143 XP_010348262.1.74449 XP_010376108.1.97406 XP_010962167.1.22495 XP_010962168.1.22495 XP_010975173.1.51371 XP_010975174.1.51371 XP_011726898.1.29376 XP_011726899.1.29376 XP_011726900.1.29376 XP_011726901.1.29376 XP_011726902.1.29376 XP_011781513.1.43180 XP_011781514.1.43180 XP_011825420.1.47321 XP_011918852.1.92194 XP_011918853.1.92194 XP_011918855.1.92194 XP_011918856.1.92194 XP_012305876.1.9421 XP_012305877.1.9421 XP_012305878.1.9421 XP_012305879.1.9421 XP_012305880.1.9421 XP_012305881.1.9421 XP_012508002.1.63892 XP_012508010.1.63892 XP_012508015.1.63892 XP_012609035.1.48125 XP_012609044.1.48125 XP_012609054.1.48125 XP_012609061.1.48125 XP_012609068.1.48125 XP_012609075.1.48125 XP_012609083.1.48125 XP_012609091.1.48125 XP_012609100.1.48125 XP_012901623.1.14098 XP_013210624.1.66349 XP_013218549.1.77405 XP_013218550.1.77405 XP_013218551.1.77405 XP_014410660.1.101512 XP_014699367.1.49734 XP_015007442.1.72884 XP_015007443.1.72884 XP_015007444.1.72884 XP_015007446.1.72884 XP_015007447.1.72884 XP_015007448.1.72884 XP_015007449.1.72884 XP_015106908.1.17985 XP_015286511.1.63531 XP_015286512.1.63531 XP_015286513.1.63531 XP_015338712.1.40921 XP_015338713.1.40921 XP_015338714.1.40921 XP_016080006.1.3490 XP_016080007.1.3490 XP_017708739.1.44346 XP_017708740.1.44346 XP_017708741.1.44346 XP_017708742.1.44346 XP_017708743.1.44346 XP_017708744.1.44346 XP_017708745.1.44346 XP_017831628.1.60252 XP_017831629.1.60252 XP_017831630.1.60252 XP_019310302.1.44245 XP_019310303.1.44245 XP_019310304.1.44245 XP_019310305.1.44245 XP_019690630.1.62641 XP_019690631.1.62641 XP_020143150.1.48125 XP_021060430.1.100879 XP_021060431.1.100879 XP_021542919.1.83697 XP_021589170.1.77405 XP_509139.1.37143 XP_848722.1.84170 XP_856953.1.84170 ENSVPAP00000006791 ENSNLEP00000013395 ENSMICP00000013186 ENSCAFP00000000162 ENSVPAP00000006791 ENSNLEP00000013395 ENSPANP00000004045 ENSPTRP00000008651 ENSSTOP00000003148 ENSOGAP00000001356 ENSSARP00000005228 ENSMMUP00000028946 ENSMMUP00000028946 gi|338827618|ref|NP_001229755.1| gi|37588861|ref|NP_919340.1| gi|5032071|ref|NP_005776.1| ENSECAP00000004743 ENSSARP00000005228 ENSECAP00000004743 ENSP00000342755 ENSP00000447303 ENSMICP00000013186 9544.ENSMMUP00000028946 9598.ENSPTRP00000008651 9600.ENSPPYP00000005297 9606.ENSP00000342755 9615.ENSCAFP00000000162 9796.ENSECAP00000004743 ENSPPYP00000005297 ENSMPUP00000001285 ENSPTRP00000008651 ENSFCAP00000019490 ENSOGAP00000001356 ENSP00000342755 ENSP00000342755 ENSP00000447303 ENSP00000484671 ENSCAFP00000000162 ENSPPYP00000005297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]