SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001286 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001286
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.69e-32
Family Single strand DNA-binding domain, SSB 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001286   Gene: ENSMPUG00000001297   Transcript: ENSMPUT00000001313
Sequence length 211
Comment pep:novel scaffold:MusPutFur1.0:GL897076.1:750967:754540:1 gene:ENSMPUG00000001297 transcript:ENSMPUT00000001313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSAQQA
PNKVVQNDSSPPAPQPTTGPPAVSPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRIT
RSQPNHTPAGPPGPSSSPVSNGKETRRSSKR
Download sequence
Identical sequences M3XQD6
XP_004773158.1.14098 XP_004773159.1.14098 XP_004773160.1.14098 XP_004773161.1.14098 XP_004773162.1.14098 XP_004773163.1.14098 ENSMPUP00000001286 ENSMPUP00000001286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]