SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001300 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001300
Domain Number 1 Region: 144-243
Classification Level Classification E-value
Superfamily EF-hand 3.1e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 674-752
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 3 Region: 842-904
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 4 Region: 2-39
Classification Level Classification E-value
Superfamily EF-hand 0.000000958
Family Eps15 homology domain (EH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001300   Gene: ENSMPUG00000001311   Transcript: ENSMPUT00000001327
Sequence length 955
Comment pep:novel scaffold:MusPutFur1.0:GL896955.1:9104377:9186477:1 gene:ENSMPUG00000001311 transcript:ENSMPUT00000001327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNDGRMDQVEFSIAMKLIKLKLQGYQLPSSLPPVMKQQPVAISSTPAFGIGGIASMPPL
TAVAPVPMGSIPVVGMSPPLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFS
RSGPGSQLNTKLQKAQSFDVASVPPAAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQAR
TILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPP
SFRRVRSGSGVSVISSTAADQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELE
KRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEE
RRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEFELEALN
DKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQEAQQMLGRLIPEKQ
ILNDQLKQVQQNSLHRDSLLTLKRALEVKELARQQLRDQLDEVEKETRSKLQEIDIFNNQ
LKELREIHNKQQLQKQKSIEAERLKQKEQERKIIELEKQKEEAQRRAPERDKPWTEHAQP
DDDHPRPRKSHEEEKPRREESVKKKDGEEKSKPDAQDKTSRLFHPHPEPAKPAVQAPWSS
TEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWLGGELKG
KTGWFPANYAEKIPENEVPAPVKPGPDPTSAPTPALAVREPPAPVAVTAPEPSTTPNNWA
DFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGE
KVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISG
PIRKSTSMDSGSSESPASLKRVASPAAKPAVSGEGENSSQIMLLRRVLGIMEYEQ
Download sequence
Identical sequences M3XQF0
ENSMPUP00000001300 ENSMPUP00000001300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]