SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001448 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001448
Domain Number 1 Region: 221-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001448   Gene: ENSMPUG00000001461   Transcript: ENSMPUT00000001478
Sequence length 464
Comment pep:known scaffold:MusPutFur1.0:GL896940.1:11585101:11656044:-1 gene:ENSMPUG00000001461 transcript:ENSMPUT00000001478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASRTQLQNNLHMESDSASETS
FPFSKEAAGEHLDHQAAHQPFPRQRFRQEPGHRSLQRDGPRSFLLDLPNFPDLSKADING
QNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSLSLTRANSGDQDYKY
ESTSDDSNFLNPPRGWDRPAPGHRTFETKEQPEYDSTDGEGDWSLWSVCSVTCGNGNQKR
TRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERW
MGCKSEFLKKYMHKVINDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKDASGPKEKLEI
YKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV
LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences M3XQU8
XP_004754266.1.14098 ENSMPUP00000001448 ENSMPUP00000001448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]