SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001559 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001559
Domain Number 1 Region: 45-252
Classification Level Classification E-value
Superfamily Macro domain-like 6.67e-51
Family Macro domain 0.0002
Further Details:      
 
Domain Number 2 Region: 329-470
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000144
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001559   Gene: ENSMPUG00000001575   Transcript: ENSMPUT00000001592
Sequence length 497
Comment pep:novel scaffold:MusPutFur1.0:GL897059.1:2325430:2391396:1 gene:ENSMPUG00000001575 transcript:ENSMPUT00000001592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGAPSQFVDVDTLPSWGNSWEDELNTSDTAAETFQEDTIRSPFLYNKDINGKVILWK
GDVALLNCTAIVNTSNENLTDKNPVSDSIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNL
AARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLED
ATHIALRTVRRFLEIHGETIEKVVFAVSELEEATYQKLLPLYFPRSLKEEYRSLPYLPAD
IGNAEGEPVVPERQIRICEKPGAPEDTQEEEAEGLGVDLSFIGSHAFARMEGDIDKQRRL
ILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGRTVMVVVGRNI
PVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRN
LKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYD
ARENGPYYTSYPPSPDL
Download sequence
Identical sequences M3XR59
XP_004771113.1.14098 XP_004771114.1.14098 XP_012900501.1.14098 ENSMPUP00000001559 ENSMPUP00000001559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]