SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001594 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001594
Domain Number 1 Region: 89-256
Classification Level Classification E-value
Superfamily TRAF domain-like 2.94e-38
Family SIAH, seven in absentia homolog 0.00000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001594   Gene: ENSMPUG00000001611   Transcript: ENSMPUT00000001628
Sequence length 267
Comment pep:novel scaffold:MusPutFur1.0:GL896968.1:2722303:2788679:1 gene:ENSMPUG00000001611 transcript:ENSMPUT00000001628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVTPTHNLKYVSSCRAIAQSAPEQ
GSFPPHHLTHHHRHHRPHHHLRHHARPHHLHHQEAGLHAAQVTPCMCPLFSCQWEGHLEV
VVPHLRQMHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHAGHPQ
FFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLA
QLFTDNGSLAIGIAITAAEVCPSEAET
Download sequence
Identical sequences M3XR94
XP_004759274.1.14098 ENSMPUP00000001594 ENSMPUP00000001594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]