SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001596 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000001596
Domain Number - Region: 1161-1210
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0429
Family Fibrinogen C-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001596   Gene: ENSMPUG00000001613   Transcript: ENSMPUT00000001630
Sequence length 1367
Comment pep:novel scaffold:MusPutFur1.0:GL897028.1:5888450:5923415:-1 gene:ENSMPUG00000001613 transcript:ENSMPUT00000001630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFVDTRTLLLLAVTSCLATCQSLQEVTARKGPVGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGIFAAQYDPGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGE
PGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGI
RGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGS
VGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGN
PGANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGN
KGEPGSAGPQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGRAGVMGP
PGPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNIGPAGKEGPMGLPGIDGRPGP
IGPAGARGEPGNIGFPGPKGPTGDPGKPGEKGHAGLAGARGAPGPDGNNGAQGPPGPQGV
QGGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGLPGEFGLPGPAGPRGERGPPGESGA
AGPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGPSGPGGLPGERGAAGVPGGKGEKGE
TGLRGEVGNPGRDGARGAPGAVGAPGPAGATGDRGEAGPAGPAGPAGPRGSPGERGEVGP
AGPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGSAGPSGPNGPPGPAGSRGD
GGPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGAHGP
PGFAGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVSGSVGEPGPLGI
AGPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNIGPVGA
VGAPGPHGPVGPTGKHGNRGEPGPAGSVGPVGAAGPRGPSGPQGVRGDKGEPGDKGPRGL
PGLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGI
RGSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATL
KSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFST
GETCIQAQPENIPVKNWYRNSKVRKHTWLGETINGGTQFEYNTEGVTTKEMATQLAFMRL
LANHASQNITYHCKNSIAYMDAETGDLKKAVVLQGSNDVELVAQGNSRFTYTVLVDGCSK
KTNEWGKTIFEYKTNKPSRLPILDIAPLDIGDANQEFRVDVGPVCFK
Download sequence
Identical sequences M3XR96
ENSMPUP00000001596 XP_004767919.1.14098 ENSMPUP00000001596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]