SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001829 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001829
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000138
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 115-186
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000265
Family VWC domain 0.065
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000051
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001829   Gene: ENSMPUG00000001846   Transcript: ENSMPUT00000001865
Sequence length 367
Comment pep:novel scaffold:MusPutFur1.0:GL896908.1:19136675:19166927:1 gene:ENSMPUG00000001846 transcript:ENSMPUT00000001865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWFLPWTLAAVTAAAAGSVPATAFSPGSTAMAFTPVPLEDTASRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYTNGQSFQPNCKYNCTCVDGAVGCTPLCLRARPPRLWCHRPRRVSIPGRCC
QQWVCDHDARRPRKTTQRHTGALAATGEMESWHRNCLTYTSPWSPCSTTCGLGVSTRISN
VNSRCWPEQESRLCSLRPCDVDIRPHIKEGKKCLAVYQPEAPMNFTLAGCISTRSYRPKY
CGVCTDSRCCIPYKSKTIDVAFQCPDGPGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
Download sequence
Identical sequences M3XRX9
XP_004743645.1.14098 ENSMPUP00000001829 ENSMPUP00000001829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]