SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001953 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001953
Domain Number 1 Region: 176-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.62e-17
Family LIM domain 0.0035
Further Details:      
 
Domain Number 2 Region: 49-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-16
Family LIM domain 0.0023
Further Details:      
 
Domain Number 3 Region: 106-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000178
Family LIM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 235-268
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000084
Family LIM domain 0.0021
Further Details:      
 
Domain Number 5 Region: 149-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000383
Family LIM domain 0.011
Further Details:      
 
Domain Number 6 Region: 9-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000234
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001953   Gene: ENSMPUG00000001971   Transcript: ENSMPUT00000001993
Sequence length 625
Comment pep:novel scaffold:MusPutFur1.0:GL896997.1:122051:286506:1 gene:ENSMPUG00000001971 transcript:ENSMPUT00000001993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKEKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGG
FFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDR
VTFNGRDCLCQLCAQPMSSSPKEASCSGNCAGCGRDIKNGQALLALDKQWHLGCFKCKSC
GKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQ
MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSESIYSRPSSSIPGSPGHTIYAKV
DNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSA
EGYQDSRDRVMHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPGNEPSSGRNSPLPYRP
DSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAP
DPSEIPKIETDHWPGPPSLAAVGADARRRSGGREDDDEELLRRRQLQEEQLMKLNSGLGQ
LILKEEMEKESRERSSLTASRYDSPLNSASHVLSSKTSSLPGYGKNGLHRPVSTDFAQYN
SYGDVSGGVRGKTRVHGLLNDWPSH
Download sequence
Identical sequences M3XSA3
ENSMPUP00000001953 ENSMPUP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]