SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001982 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001982
Domain Number 1 Region: 404-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 465-515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 518-573
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 352-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 261-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001982
Domain Number - Region: 590-637
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000243
Family Hormone receptor domain 0.006
Further Details:      
 
Domain Number - Region: 945-1121
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00229
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001982   Gene: ENSMPUG00000002001   Transcript: ENSMPUT00000002023
Sequence length 1568
Comment pep:novel scaffold:MusPutFur1.0:GL896908.1:26096081:26159055:1 gene:ENSMPUG00000002001 transcript:ENSMPUT00000002023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQAAAPGPLCRILCLRPPLLLLLLVLGRRARAAAGADAGPGAEPCATLVQGKFFGYFS
AAAVFPSNASRCSWTLRNPDPRRYTLYMKVAKPPAPCGGPGRIRTYQFDSFLESTRTYLG
VESFDDVLQLCDPSAPLAFLQASKQFLQMLRQQPPPDPGPRLLGASPGPSDDFSVEYLVV
GNRHPSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACVGGDGGAPAPRGDVCLRDGVA
GGPENCLTSLTQDRGGDGAAGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGAEGGGCEG
VLEEGRLCNRKACGPAGRASSRSQSLRSTDARRREELGDELQRFGFPSPQTGDPAAEEWS
PWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLC
SSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACSA
SCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQTWASWGGCSVTCGGG
TQRRERVCSGPFFGGAACQGPQDEQRPCGAQRCPEPHEICDEDNFGTVVWKETPAGEVAA
VRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGEG
VSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDAQNFVQIISNLLA
EENRDKWEEAQLMGPNAKELFRLVEDFVGVIGFRMKDLRDAYQVTDNLVLSIHKLPASGA
ADISFPMKGWRATGDWAKVPEDRVTVSRSVFSTGLAEADDSSVFVVGTVLYRNLGSFLAL
QRNTTVLNSKVISVTVKPPPRSLLTPLEIEFAHLYNGTTNQTCILWDESDVLSTRAAPQL
GPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADASMEKVIVPSVTLIVGCGVSSLT
LLLLIIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHFF
FLSSFCWVLTEAWQSYMAVTGRLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTMN
YCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCV
VLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVD
RQEEGNGDSGGSFQNGHAQLMAQCEAGDTEACQGDIPGPGSGAGRTQTVRSGDWRRPTLT
PGDQPGLCTHPAPTMALFPARSLQHCLHSARLSPGRTRPFLPPHPLPCGRRPHLWKPVLE
LWLSRGEAGAMQGRALSPGDRPWTPCAGPGPVLSLPCPLPRRPHTHSSSWLFTILGGAGR
LGKLCEGSCPPPPCHPPRRPPLPALPPRCPRPAGPRGRGRPASAGTGVCKERPGPVAWEV
LGNCLQTCTNPFSPQRRKSRYAELDFEKIMHTRKRHQDLFQDLNRKLQHAEKDKEALGPD
SKQPEKQQTPNKRPWESLRKAHGTPAWVKKELEPLPPSPLELRSVEWEKSGATIPLVGQD
IIDLQTEV
Download sequence
Identical sequences M3XSD2
ENSMPUP00000001982 ENSMPUP00000001982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]