SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002022 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000002022
Domain Number - Region: 344-399
Classification Level Classification E-value
Superfamily SH3-domain 0.000156
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002022   Gene: ENSMPUG00000002043   Transcript: ENSMPUT00000002065
Sequence length 413
Comment pep:known scaffold:MusPutFur1.0:GL896997.1:2043762:2060336:1 gene:ENSMPUG00000002043 transcript:ENSMPUT00000002065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILYNYFNAMFIGPGFVPLGWKPENSQDSMYLQYCKVCQAYKAPRSHHCRKCNR
CVMKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYNRLSFGWNT
VKIDMSAARRDPLPIIPFGLAAFAATLFALGLALGTTIAVGMLFFIQMKIILRNKTSIES
WIEEKAKDRIQYYQLDEVFVFPYDMGSRWKNFKQVFTWSGVPEGDGLAWPVRKDCHPYSL
TIEQLKQKADKRVRSVRYRVIEDYSGACCPLNKGIKTFFTSPCTEEPRIRLQKGEFILAT
RGLRYWLYGDKILDDASVEGVSRIRGWFPRNCVEKCPCDAETDQAPEGEKKNR
Download sequence
Identical sequences M3XSH2
ENSMPUP00000002022 XP_004763894.1.14098 XP_004763896.1.14098 ENSMPUP00000002022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]