SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002172 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002172
Domain Number 1 Region: 333-403
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002172   Gene: ENSMPUG00000002194   Transcript: ENSMPUT00000002216
Sequence length 413
Comment pep:novel scaffold:MusPutFur1.0:GL897087.1:3225488:3227441:1 gene:ENSMPUG00000002194 transcript:ENSMPUT00000002216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQLCQGHFLEAPPPGQALLLCGAQALSLAPLDIIQTHYQPWGFLSAAHTVCPGLFEELL
LLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLLLSAHSTLQLARARGQEGP
GDMDRAVHGERVKGVGAPEGGEDEEEEETEEVAEAAGGSGRGRWARGGQAGWWYQLMQSS
QVYIDGSTEGSRFPRGGSNSSEKKKGAGGGGPPPREGVVEGAEACPAPEETLGRDRGWPF
WMGSPPDSVLAELRRSREREGSTAPPAENEEGASEPSPGGIKWGHLFGSRKAQRETRPTN
RLPSDWLSLDKSMFQLVAQTVGARREPEPKESLQEPHSPVLPSKPPCEVKALCHHLATGP
GQLSFHKGDILRVLGPAGGDWLRCSRGPDTGLVPLAYVTLTPTPSPTPGSSQN
Download sequence
Identical sequences M3XSX2
ENSMPUP00000002172 ENSMPUP00000002172 XP_004774188.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]