SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002222 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002222
Domain Number 1 Region: 1247-1297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 596-659
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 995-1042
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 179-227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 336-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 1053-1122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 736-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 8 Region: 1128-1176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000562
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 1367-1431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000101
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 10 Region: 663-731
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 11 Region: 1180-1232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 12 Region: 920-994
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000615
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 13 Region: 794-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000628
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 14 Region: 1297-1352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000889
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002222
Domain Number - Region: 42-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000157
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number - Region: 866-920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00275
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number - Region: 102-174
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00798
Family TSP-1 type 1 repeat 0.015
Further Details:      
 
Domain Number - Region: 479-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00916
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 
Domain Number - Region: 396-478
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.017
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002222   Gene: ENSMPUG00000002246   Transcript: ENSMPUT00000002268
Sequence length 1607
Comment pep:novel scaffold:MusPutFur1.0:GL897092.1:59157:916366:-1 gene:ENSMPUG00000002246 transcript:ENSMPUT00000002268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSKGNLAVPCWLWRSMRKLFLLLSVLLSHAAHLEGKKDNQFIWKPGPWGRCTGDCGPGG
VQSRALWCFHAEGRTSPVSNCDENHRPPKERSCFRVCDWHSDLFQWEVSDWHRCVLAPAS
AGQAPPRTAACVTAQHGLQDRTVRCVQKLNRTRVVNEICEHFAPQPPTEQACLVPCPRDC
IVSEFSPWSECREGCEKQLQHRTRAAIAPPLYGGSPCPNLTESRACDTPISCPLGEEEYT
FSLKVGPWSKCRLPHLKEINLSGRAVLDFSSDSKERVTFRHQSYKPHHLSRPWDLDIGYQ
TRQVWCTRSDGKNAMLSLCVQDSFPLTVQSCIMPKDCETTEWSSWSPCSKTCRSGSLSPG
FRSRRRNVKHIAIGGGKECPELLEKEACIVEELLQPCPRYAWRTSEWKECQVSLLLKQQD
PHWHVTGPVCGGGIQTRDVYCAQSTPVSTAQKAKEVSRPVKKTSCLGPAPSASQLCNLPC
STDCVVSSWSAWGLCAHESCRDPQGRKGFRLRRRHVLMESTGPAGHCPHLVESVPCEDPM
CYRWLVSEGICIPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPASPPPERMACEIPCRMD
CVLSEWTEWSSCSQSCSNKNSDGKQTRSRTILALAGEGGKPCPPNQALQEYRSCNDHSCM
QLYWETLPWGPCSEDTLVTALNATIGWTGEATCGVGIQTRRVFCVKNHVGQVMAKRCPDS
TRPETVRPCLLPCKKDCIVTAFSEWTPCPRSCQPGNATVKQSRYRIIIQEAANGGQECPD
TLFEERECEDISLCPIYRWKPQKWSPCILVPESVRQAIMGTSEACGKGVQTRAVSCVSDD
NQSAEMMECLKQTNGMPPLVQECTVPCRDDCTFTVWSKFTPCSTNCETTRSRRRQLTGKS
RKKEKCQDSDLYPLIETELCPCDVFISQPYGNWSDCILPEGRRESQRGYRVQGDSKECGK
GLRFRAIACSDKNGRPVDPSHCSSSGYIQEECVIPCPFDCKLSDWSSWGSCSSSCGIGVR
IRSKWLKEKPYNGGRPCPRLDLKNQAQVHEAVPCYSECNQYSWVVEHWSPCKIHNELRSL
RCGGGTQSRKIRCVNAADSEGGAVDNSLCSQDEIPPETQPCSLLCPSECVMSEWGSWSKC
PQSCDPHSTQRRTRHLLRPSLNSRTCAEDSQVRPCLLNENCFQFQYNLTEWSTCQLSENA
TCGRGVRTRLLSCVRSDGKPVGVDQCEQRNLEKPQRMSIQCLVECAVNCQLSGWTAWTEC
SKTCGHGGQMSRARFVIMPTQGEGRPCPTELTQQKTCPVMPCYSWVLGNWSACKLEGGDC
GEGVQIRSLSCMVHNGSSSQSAVSVDAALCGEMPFQDSILKQPCSVPCPGDCHLMEWSEW
STCELTCINGRSFETMGRQSRSRAFIIQSFENQDSCPQQVLETRPCTGGKCYHYTWKASL
WNNNERTVWCQRSDGINVTGGCAPQARPAAIRQCNPACKKPFSYCTQGGVCGCEKGYREI
MRSNGFLDYCMKVPGSEEKKADVKNLAGKNRPVNSKIHDIFKGWSLQPLDPDGRVKIWVY
GVSGGGFLIMIFLVFTSYLLCKKPKPHQSTPPQQKPLTLAYDGDLDM
Download sequence
Identical sequences M3XT22
ENSMPUP00000002222 ENSMPUP00000002222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]