SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002285 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002285
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000384
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002285   Gene: ENSMPUG00000002309   Transcript: ENSMPUT00000002331
Sequence length 207
Comment pep:novel scaffold:MusPutFur1.0:GL896944.1:1021073:1025012:-1 gene:ENSMPUG00000002309 transcript:ENSMPUT00000002331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCPRCMQCDAKFDFLTRKHHCRRCGKCFCDKCCGQKVPLRRMCFVDPVRQCAECALVSHK
EAEFYDKQLKVLLSGATFLVTLGDAEKPETMVCRLSGNQRYLLLEGDSRHEIEITRISAV
QVLTEGFQAGEKDSHAYTSLLGSQPVSEGGNARATGMSLQYTAPGAEGTTQLKLTAGEDA
SASRRQSTAWLVAMHKATKLLYESRDQ
Download sequence
Identical sequences M3XT85
ENSMPUP00000002285 ENSMPUP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]