SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002311 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002311
Domain Number 1 Region: 122-288
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.19e-50
Family CRAL/TRIO domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 24-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.45e-18
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002311   Gene: ENSMPUG00000002335   Transcript: ENSMPUT00000002357
Sequence length 354
Comment pep:novel scaffold:MusPutFur1.0:GL897171.1:561841:739818:-1 gene:ENSMPUG00000002335 transcript:ENSMPUT00000002357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVSILPKYQKLSTWKGDSAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYNDENDYTH
TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENDNTQPLLALD
Download sequence
Identical sequences M3XTB1
ENSMPUP00000002311 ENSMPUP00000002311 XP_004778413.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]