SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002382 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002382
Domain Number 1 Region: 116-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.61e-113
Family Pancreatic carboxypeptidases 0.0000000024
Further Details:      
 
Domain Number 2 Region: 17-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.42e-25
Family Pancreatic carboxypeptidase, activation domain 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002382   Gene: ENSMPUG00000002408   Transcript: ENSMPUT00000002431
Sequence length 417
Comment pep:novel scaffold:MusPutFur1.0:GL896947.1:29148:65198:1 gene:ENSMPUG00000002408 transcript:ENSMPUT00000002431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTFLLLVTLALASSHHSGEHFEGEKVFRVNVEDENHINLLHKLASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDIFTVEDFLEQNELQYEVLISNLRSVLEGQFDSQVRSTGHSYEKYN
KWETIEAWTQQVTSENPGLISRRAIGTTFEGRTMYLLKVGKAGPNKPAIFMDCGFHAREW
ISPAFCQWFVREAIRTYGQEIHMTELLDKLDFYVLPVVNIDGYVYTWTKNRMWRKTRSTQ
AGTTCIGTDPNRNFDAGWCKIGASRSPCDETYCGPAAESEKETKALANFIRSNLSSIKAY
LTIHSYSQMMLYPYSYDYKLTENNAELNALAKATIKELATLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFALPESQIRPTCEETMLAIKYLARYVLGHLY
Download sequence
Identical sequences M3XTI2
ENSMPUP00000002382 ENSMPUP00000002382 XP_004755540.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]