SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002532 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002532
Domain Number 1 Region: 277-492
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.79e-85
Family Fibrinogen C-terminal domain-like 0.00000246
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002532
Domain Number - Region: 205-272
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002532   Gene: ENSMPUG00000002561   Transcript: ENSMPUT00000002584
Sequence length 495
Comment pep:novel scaffold:MusPutFur1.0:GL897021.1:552165:607577:1 gene:ENSMPUG00000002561 transcript:ENSMPUT00000002584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQIVFFTLGCDLVLAAAYNNFRRSMDSIGRRQYQVQHGACSYTFLLPETDNCRSSSSYV
PNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKREMVEMQQNAVQNQT
AVMIEIGTNLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
NKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHNLLTMISTSNSAKNSFDVKEEQVIFRDCAEVFKSGLTANGIYTLT
FPNSTEEVKAYCDMETSGGGWTVIQRREDGSVDFQKTWKEYKVGFGNPSGEHWLGNEFVF
QVTNQQPYVLRIHLQDWEGNEAHSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQKQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPAGF
Download sequence
Identical sequences M3XTY2
XP_004766804.1.14098 ENSMPUP00000002532 ENSMPUP00000002532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]