SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002560 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002560
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-33
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1361-1481
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 3 Region: 844-950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1194-1303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 5 Region: 663-784
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 6 Region: 1719-1822
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1532-1651
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-28
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 8 Region: 503-606
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-26
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 9 Region: 323-432
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 10 Region: 1011-1126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-22
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 11 Region: 1-90
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-22
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 12 Region: 2072-2140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 13 Region: 2428-2499
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.23e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 2312-2380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 2129-2198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2187-2260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2369-2439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 18 Region: 2608-2676
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000121
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 2546-2603
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000133
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 20 Region: 783-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 1886-1953
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 90-157
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 608-678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 24 Region: 957-1021
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 2244-2306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 2014-2076
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 1133-1196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000634
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 265-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000715
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 2490-2551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 30 Region: 1824-1897
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 31 Region: 1479-1548
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1307-1371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000806
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 438-498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000256
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 34 Region: 1650-1714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000216
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 2663-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 36 Region: 1967-2024
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002560   Gene: ENSMPUG00000002589   Transcript: ENSMPUT00000002613
Sequence length 2957
Comment pep:novel scaffold:MusPutFur1.0:GL897021.1:3656871:4044609:1 gene:ENSMPUG00000002589 transcript:ENSMPUT00000002613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAIKDDGISDITVLGTFSGHEVPSQLASSG
HIVRLEFQSDHSTTGRGFNITYTTFGQNECHDPGIPINGRRFGDRFLLGSSVSFHCDDGF
VKTQGSESITCILQDGNVVWSSTVPRCEAPCGGHLTASSGLILPPGWPGYYKDSLNCEWI
IEAKPGHSIKITFDRFQTEVNYDTLEVRDGPANSSPLIGEYHGTQAPQFLISTGHFMYLL
FTTDNSRSSVGFLIHYESVTLESDSCLDPGIPVNGHRHGSNFAIRSTVTFSCDPGYTLSD
DEPLICERNHQWNHALPSCDALCGGYIHGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKG
VQMMFHTFHLESSHDYLLITEDGSFSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFS
ISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFHFGVGDSLTFSCFPGYRLEGASKLTCLG
GGRRVWSAPLPRCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRAR
SFQLFEGDILKVYDGRDSSSRPLGAFTKNELMGLVLNSTSNHLWLEFNTNGSDTDQGFQL
TYTSFDLVKCEDPGVPNYGYRIRDEGHFTDTVVLYSCNPGYAMHGSDTLTCLSGDRRVWD
KPLPSCVAECGGQIHAATSGRILSPGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTET
AHDTLKVWDGPRDSDILLKEWSGSLLPEDIHSTFSALTLQFDSDFFISKSGFSIQFSTSV
ASTCNDPGMPQNGTRYGDSREPGDTITFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTC
IAACGGNLTGPAGVILSPNYPQPYPPGKECDWRIKVNPDFVIALIFKSFNMEPSYDFLHI
YEGEDSNRPLLGSFQGSQAPERIESSGNSVFLAFRSDASVGLSGFAIEFKEKPREACFDP
GNIMNGTRIGTDFKLGSSVTYQCDSGYKIVDPSSITCVIGADGKPAWSQALPSCNAPCGG
QYTGSEGVVLSPNYPHNYTAGQICLYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHPQ
ARLLSSLSGSHSGETLPLATSNQILLRFSAKSGASARGFHFVYQAVPRTSDTQCSSIPEP
RYGRRIGSEFSAGSIVRFECNPGYLLQGSTAIRCQSVPNALAQWNDTIPSCIVPCSGNFT
QRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGIQIQVISFATEQNWDSLEIYDGGDMAAP
RLGSFSGTTVPALLNSTSNQLFLNFQSDISVAAAGFHLEYKTVGLAACQEPALPSNGIKI
GDRYMVNDVLSFQCEPGYTLQGRSHTSCMPGTVRRWNYPSPLCIATCGGTLSSMGGVILS
PGFPGAYPNNLDCTWKIELPVGYGAHIQFLNFSTEANHDYLEIQNGPYHTSPMIGQFSGP
DPPSALLSTTHETRIHFYSDHSQNRQGFKLTYQAYELQNCPDPPPFQNGYMVNADYSVGQ
SISFECYPGYILLGHPVLTCQHGINRNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYP
ILKDCLWLITVLPGHGVYINFTLLQTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYS
STNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPSVPQAEMLMEDEDFEIGDFVKYQCH
PGYTLSGTDTLTCKLSAQLQFEGALPTCEAQCPANEVRTESSGVILSPGYPGNYFNSQTC
SWSIKVEPHYNITIFVDTFQSEKQFDALEVFDGSSGQSPLLVVLSGNHTEQLNFTSRSNQ
LYLRWSTDHATSKKGFKIRYTAPYCSLTHTLKNGGVFNRTTGALGSKVHYFCKPGHRMIG
HSNATCQRSPGGMYQWDSLAPLCQAVSCGIPESPGNGSFTGNEFTLDSKVTYECNEGFQL
EAGQQAVAVCREDGLWNNTGKPPMCKPVTCPSIEAQLSDHVTWRLVSGSLNEYGAQVVLS
CSPGYFLESQRLVQCQANGTWSIGEERPRCRVISCGSLSFPPNGNKIGTLTVYGATAIFT
CNTGYTLVGSHVRECLANGLWSGTETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCT
PGFRLVGTSVRICLQDHKWSGQTPVCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCSTG
YLLQGAARAQCRSNGQWSSALPTCRVVNCSDPGFVENAIRLGQQNFPESFEYGMSVMYHC
KKGFYLLGSSALTCMANGLWDRSLPKCLVISCGHPGVPANAILTGELFTYGAVVHYACKG
SWDLVGNSTRVCQDDSHWSGTLPHCTGNDPGFCGDPGTPAHGSRLGDELKAKSLLRFSCE
MGYQLRGSPERTCLLNGSWSGLQPVCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWE
GYKTSGLMTRHCTANGTWTGTAPDCTVISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGY
LMEPITSSTIRCTKDSTWNSSKPVCKAVMCGQPPHVLHGKVEGTDFRWGASVSYSCVDGF
QPSHSAILSCEGHGVWKGEVPQCLPVFCGDPGTPAEARLSGKSFTYKSEVFFQCKSPFVL
VGSSRRTCQADGTWSGTQPTCIDPAHNSCPDPGTPPFGIQNSSRGYEVGSTVFFRCRKGY
HIQGSTTRTCLANLTWSGIQTECIPHTCRQPETPAHADVRAIDLPTFGYTLVYTCHPGFF
LAAGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFVNSVWKGYYEYLGK
RQPATLTVDWFNATSSKVNATFLEASQVELKLTGIYKKEEAHLLLKAFQIKGPADIFVSK
FENDNWGLAGYVSSGLERGGFTFQGDIHGKDFGRFKLERQDPLSSDQDAPNQHQGTSSGS
VAAAILVPFFALILSGFAFYLYKHRTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTE
AKAVRFDTTLNTVCTVV
Download sequence
Identical sequences M3XU10
ENSMPUP00000002560 ENSMPUP00000002560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]