SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002588 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002588
Domain Number 1 Region: 133-321
Classification Level Classification E-value
Superfamily TRAF domain-like 2.55e-61
Family SIAH, seven in absentia homolog 0.0000000107
Further Details:      
 
Domain Number 2 Region: 72-138
Classification Level Classification E-value
Superfamily RING/U-box 0.00000286
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002588   Gene: ENSMPUG00000002618   Transcript: ENSMPUT00000002642
Sequence length 324
Comment pep:novel scaffold:MusPutFur1.0:GL896947.1:1799502:1816056:-1 gene:ENSMPUG00000002618 transcript:ENSMPUT00000002642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSSTGPSANKPCSKQPPPQPQPAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGG
GGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTP
SIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGS
LEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYE
GHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFD
TAIAHLFADNGNLGINVTISTCCP
Download sequence
Identical sequences M3XU38
ENSMPUP00000002588 XP_004755603.1.14098 ENSMPUP00000002588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]