SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002651 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002651
Domain Number 1 Region: 316-390,433-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-80
Family Protein kinases, catalytic subunit 0.00000000248
Further Details:      
 
Domain Number 2 Region: 6-226
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-31
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 3 Region: 675-747
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.45e-20
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002651   Gene: ENSMPUG00000002679   Transcript: ENSMPUT00000002706
Sequence length 752
Comment pep:novel scaffold:MusPutFur1.0:GL897075.1:751070:1239220:-1 gene:ENSMPUG00000002679 transcript:ENSMPUT00000002706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACTRPPSAPRNVAFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGG
LRFIPRHSGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSL
IGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKVYPRIAPAFWHYLRVEEHEQLT
YSSTRSKAPSVIITGLKPATKYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQIL
VIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQQNGHLRFPGIKTYID
PDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGG
HMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVETFCPSFLRAGFLNSIQAP
HPVPGGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKY
LSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPIRWTAPEAI
AYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQL
MLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVVNGPHSQCPSTELSNCSMA
VEAGRMPESPGEVPEYPLFVTVGEWLDSIKMGQYKNNFMAAGFTTFDLISRMSIDDIRRI
GVLLIGHQRRIVSSIQTLRLQMMHIQEKGFHV
Download sequence
Identical sequences M3XUA1
ENSMPUP00000002651 ENSMPUP00000002651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]