SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002871 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002871
Domain Number 1 Region: 438-512
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000424
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002871   Gene: ENSMPUG00000002900   Transcript: ENSMPUT00000002930
Sequence length 527
Comment pep:novel scaffold:MusPutFur1.0:GL896947.1:10338753:10373986:-1 gene:ENSMPUG00000002900 transcript:ENSMPUT00000002930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGVGVAESSDDPHNAPSEGKGISQLLPCKPASLHEGQGVTEEGGTPPQTGEDSSSESS
SESESDNEEPEPEQINGEPGGSCVEEASAQTEEWEEKELPKEHSHSELQKIQPHCEHCNV
ENKQNEQVTPRPLSREQFLLKLDTEGTYQCTETGLIFEVNRKVDIKYCVLSWSKFADLVV
KPWVVGGPLFDVKCDPTCLTSIQFPHSLCLGHHNANMTFKVLHVKSSGASLESTMDHSTT
HVKWRVSSLSPVGPVIQSEETVYHHGAVILYKAIDQNPSLSFRVYIATNNESFIKDISKS
VKHSSKKFMKIDKPPVCQKLLENGKKYRLISEPEAEITPEEIEFVDGSLLKLKSYIEVYL
EQPVEFKLLLVEMDSEEIVWKAKLRECDWVQHDQNQNISKRSTNGNRRRKMTSSLPDEDI
YDKRMKQVDSSDGAKTRTLLTDAQLITLAARLGREWIKIAIANLELEISDIDDIREKEED
VTMCNFRMLKKWQEKEQGNATAENLSKCLKNVSVEVQDVLKGFLQER
Download sequence
Identical sequences M3XUX1
ENSMPUP00000002871 ENSMPUP00000002871 XP_004755711.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]