SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002889 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002889
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002889   Gene: ENSMPUG00000002918   Transcript: ENSMPUT00000002948
Sequence length 525
Comment pep:novel scaffold:MusPutFur1.0:GL896910.1:1070020:1118164:-1 gene:ENSMPUG00000002918 transcript:ENSMPUT00000002948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNLEIDCHISLVLLITILVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTGS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQVTKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQAHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences M3XUY9
ENSMPUP00000002889 ENSMPUP00000002889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]