SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002937 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002937
Domain Number 1 Region: 213-272
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-21
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 2 Region: 34-88
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002937
Domain Number - Region: 275-328
Classification Level Classification E-value
Superfamily SH3-domain 0.001
Family SH3-domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002937   Gene: ENSMPUG00000002965   Transcript: ENSMPUT00000002996
Sequence length 330
Comment pep:novel scaffold:MusPutFur1.0:GL896969.1:2757952:2853456:-1 gene:ENSMPUG00000002965 transcript:ENSMPUT00000002996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEVSPSSSPLPASGSLTSTPTRASLHPGAGGKAHAFQEHIFKKPTFCDVCNHMIVGAN
AKHGLRCKACKMSLHHKCMDGLAPQRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIAC
GNKVDPVYETLRFGTSLAQRTKKGSSGSGSESPHRTSTSDLVEVPEEVDGPGGGYDPRKR
SNSVFTYPENGTDDSRHQAKNISQQGSLSKEPLQMNTYVALYKFVPQENEDLEMRPGDMI
TLLEDTNEDWWKGKIQDRIGFFPANFVQRVQQNEKIFRCVRTFLGCKEQGQMTLKENQIC
VTSEEEQDGFIRVLSGKKRGLVPLDVLENI
Download sequence
Identical sequences M3XV37
ENSMPUP00000002937 XP_012915519.1.14098 XP_012915520.1.14098 ENSMPUP00000002937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]