SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002990 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002990
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-24
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002990
Domain Number - Region: 100-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000968
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002990   Gene: ENSMPUG00000003020   Transcript: ENSMPUT00000003051
Sequence length 198
Comment pep:novel scaffold:MusPutFur1.0:GL897021.1:6223655:6243319:-1 gene:ENSMPUG00000003020 transcript:ENSMPUT00000003051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQESVTFDDVAVDFTQEEWTLLDRSQRKLFRDVMLENISHLVSIGRQLYKSETISHLE
PGEHLSKGLGLLQCQSLDREDDLKKQEMILVQHVCKKDTALVGAMRSHTLENPFECNDFG
ENLTEILTWTQYVVPKMGKNPCISKECGKDSSCSPSFNTRGISWFHPTLLELSFPGAETR
LSRTSVSRLRLKRQHLAK
Download sequence
Identical sequences M3XV90
ENSMPUP00000002990 ENSMPUP00000002990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]