SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002999 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002999
Domain Number 1 Region: 124-312
Classification Level Classification E-value
Superfamily TRAF domain-like 6.41e-63
Family SIAH, seven in absentia homolog 0.00000000355
Further Details:      
 
Domain Number 2 Region: 65-127
Classification Level Classification E-value
Superfamily RING/U-box 0.00000242
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002999   Gene: ENSMPUG00000003029   Transcript: ENSMPUT00000003060
Sequence length 313
Comment pep:novel scaffold:MusPutFur1.0:GL896910.1:2287466:2290712:-1 gene:ENSMPUG00000003029 transcript:ENSMPUT00000003060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKSPLPFLYSWRGVLLTCLPAAGTRKRKEMSRQTATALPTGTSKCTPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
Download sequence
Identical sequences M3XV99
ENSMPUP00000002999 XP_004744183.1.14098 XP_008700880.1.72690 XP_021561506.1.83697 ENSMPUP00000002999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]