SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003034 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003034
Domain Number 1 Region: 818-1094
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000769
Family Rhodopsin-like 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003034
Domain Number - Region: 182-358
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00416
Family YVTN repeat 0.042
Further Details:      
 
Domain Number - Region: 440-479
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00667
Family Hormone receptor domain 0.0056
Further Details:      
 
Domain Number - Region: 128-166
Classification Level Classification E-value
Superfamily Caspase-like 0.0404
Family Caspase catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003034   Gene: ENSMPUG00000003065   Transcript: ENSMPUT00000003096
Sequence length 1435
Comment pep:known scaffold:MusPutFur1.0:GL896921.1:723897:750641:1 gene:ENSMPUG00000003065 transcript:ENSMPUT00000003096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSATRTLSRWRMCSATCPMPSRSCHRGVTTAPSAWWLPARTPFLTPVLGPTSTWRCST
TVSPTKWSRKGMGGWGGAPHLSDISAALVPPPEPGMVAVFVCPGTLQKVLEPTSTHESEH
QSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVASRHTTTYRLPNRVDGTGFVV
YDGAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLW
VIYATEGNNGRLVVSQLNPYTLRFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSE
AAGNRVDYAFNTNANREEPVSLAFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGP
PDPSAGPATSPPLSTTTTARPTPLTSTASPAATTPLRRVPLTTHPVGAINQLGPDLPPAT
ALAPSTRRPPAPNLHVSPELFCEPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPA
LGLWNPRGPDLSNCTSPWVNQVAQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLME
QLLDILDAQLQALRPIERESAGKNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKD
MNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKQNVVLEVTVLNTEGQVQELVFP
QEYPSENSIQLSANTIKQNSRNGVVKVVFILYNNLGLFLSTENATVKLAGEAGTGGPGGA
SLVVNSQVIAASINKESSRVFLMDPVIFTVAHLEAKNHFNANCSFWNYSERSMLGYWSTQ
GCRLVESNKTHTTCACSHLTNFAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICI
STFCFLRGLQTDRNTIHKNLCINLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFS
WLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKACWLRV
DNYFIWSFIGPVSFVIVVNLVFLMVTLHKMVRSSSVLKPDSSRLDNIKSWALGAIALLFL
LGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCI
RSPPGGAHGSLKTSAMRSNTRYYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRG
TMGNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGM
DTLPLNGNFNNSYSLRSGDFPPGDGASEPPRGRNLADAAAFEKMIISELVHNNLRGSSSG
AKGPPPPEPPVPPVPGGGGEEEAGGPGGADRAEIELLYKALEEPLLLPRAQSVLYQSDLD
ESESCTAEDGATSRPLSSPPGRDSLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGP
PEIYYTSRPPALVARNPLQGYYQVRRPSHEGYLAAPGLEGPGPDGDGQMQLVTSL
Download sequence
Identical sequences M3XVD4
ENSMPUP00000003034 ENSMPUP00000003034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]