SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003108 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003108
Domain Number 1 Region: 17-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-74
Family FCH domain 0.0016
Further Details:      
 
Domain Number 2 Region: 382-443
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-19
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003108   Gene: ENSMPUG00000003139   Transcript: ENSMPUT00000003171
Sequence length 444
Comment pep:novel scaffold:MusPutFur1.0:GL897054.1:1415836:1421197:1 gene:ENSMPUG00000003139 transcript:ENSMPUT00000003171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYAQQL
TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDA
YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTE
QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLDDVGKTTPQYMESMEQVFEQCQQFEEK
RLVFLKEVLLDIKRHLNLAENSSYVHVYRELEQAIRGADAQDDLRWFRSTSGPGMPMNWP
QFEEWNPDLPHTATKKEKQPKKAEGVTLTNATGVVETTSQAGDRGSVSSYDRGQPYATEW
SDDESGNPFGGSEANGGSNPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE
QGWCRGRLDSGQLGLYPANYVEAI
Download sequence
Identical sequences M3XVK8
ENSMPUP00000003108 XP_004770711.1.14098 XP_004770712.1.14098 XP_004770713.1.14098 XP_004770714.1.14098 ENSMPUP00000003108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]