SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003137 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003137
Domain Number 1 Region: 31-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-20
Family V set domains (antibody variable domain-like) 0.00021
Further Details:      
 
Domain Number 2 Region: 256-343
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 149-241
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000927
Family C2 set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003137   Gene: ENSMPUG00000003170   Transcript: ENSMPUT00000003202
Sequence length 408
Comment pep:novel scaffold:MusPutFur1.0:AEYP01109532.1:21:6612:-1 gene:ENSMPUG00000003170 transcript:ENSMPUT00000003202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADADMVSLLLLPLLWGGSLQEDWGYQLRVQDTVTVQEGLCVHVPCSFSYPWSSWPTGE
RPYMYWFQSGDSSHNSQLVATNDPTKTVKTEFRDRFNLVRKPQENDCSLRIREARRSDQG
LYKFQIGKDYVRYTYRDKQLNLQVAALTQEPDIHFLEPLKSGYPTNLTCSLRGSCEEGRP
LSFFWMGGALDSLDPQTLHSSVLTLTPRVQDHGSNLTCQVHLPGVQGTVERTIRLNVSYA
PQLMTTRVLQGNYTVPKMLSNGMSLPVLEGQFLSLVCIADSNPPAMLSWSREGKALSPSQ
PSAPGVLELLHVGVEDEGEFTCQAQNPLGSQCISISLSVRRSPSSCNCVSEKQEGSWPLV
LTLIRGFLMGAGFLLAYGLTWIYYTRCGDPQGSGPRGLSEPLSFSRWD
Download sequence
Identical sequences M3XVN7
ENSMPUP00000003137 XP_012906408.1.14098 ENSMPUP00000003137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]