SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003151 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003151
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily PX domain 3.79e-23
Family PX domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003151
Domain Number - Region: 193-281
Classification Level Classification E-value
Superfamily TPR-like 0.00455
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003151   Gene: ENSMPUG00000003184   Transcript: ENSMPUT00000003216
Sequence length 316
Comment pep:known scaffold:MusPutFur1.0:GL896910.1:4339593:4348757:-1 gene:ENSMPUG00000003184 transcript:ENSMPUT00000003216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLEHPGSPGWTGPTAKGTAGPRQEASATGRDLPCPGPEGHLDAPGSPSPNSSMTTREL
QEYWRKEKRCWRRIKLLFEVASARIEERKVSKFVMYQIVVIQTGSFDSNKAVLERRYSDF
EMLQKNLLKTFREEIEDIAFPKKHLVGNFTEEMISERKLAFKEYLTLLYAIRCVRRSREF
IDFLTRPELREAFGCLRGGQYGRALDILVRVVPLQEKLTAHCPVMVVPALCAMLVCHRDL
ERPAEAFAAGERALQCLQAREGHRYYAPLLDAMIRLAYELGKDFVSLQEKLQESQLRQPS
PWGFTLKELTVREYLY
Download sequence
Identical sequences M3XVQ1
ENSMPUP00000003151 XP_004744215.1.14098 ENSMPUP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]