SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003468 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003468
Domain Number 1 Region: 51-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.01e-49
Family BAR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003468   Gene: ENSMPUG00000003498   Transcript: ENSMPUT00000003535
Sequence length 289
Comment pep:novel scaffold:MusPutFur1.0:GL896992.1:5076148:5118101:1 gene:ENSMPUG00000003498 transcript:ENSMPUT00000003535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGGVTSLPGDWLNPEVIPEDPVAAEDPGGRASFGTMSWIPFKIGQPKKQIVPKTVERDF
EREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQDFLNMVTA
LDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQAKVEK
YEEKEKTGPVLAKLHQAREELRPVRDDFEAKNKQLLDEMPRFYHSRLDYFQPSFEALIRA
QVGYYSEMQKIFGDLTQQLDQPGNPDEQRERENEARLSELRALSIVADD
Download sequence
Identical sequences M3XWL8
XP_004763343.1.14098 ENSMPUP00000003468 ENSMPUP00000003468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]