SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003528 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003528
Domain Number 1 Region: 331-423
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.13e-24
Family Tudor domain 0.00000335
Further Details:      
 
Domain Number 2 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000757
Further Details:      
 
Domain Number 3 Region: 50-121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003528   Gene: ENSMPUG00000003558   Transcript: ENSMPUT00000003595
Sequence length 560
Comment pep:known scaffold:MusPutFur1.0:GL897134.1:531509:545325:1 gene:ENSMPUG00000003558 transcript:ENSMPUT00000003595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTERTSWTSLSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVP
QEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVRREEVAESGGAGEPALWKNA
GTGTVPEPATLPGSPPRKGGGDVVGPESAWEKSNGDSFQKSGAQTSPEMSMFEIPSPDFS
FHADEFLEVYVSASEHPNHFWIQIIGSRSLQLDKLVSEMTQHYENSLPEDLTVHVGDIVA
APLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSL
ARIAPSGEQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKLD
IGLELVRKGYAVELPEDVEGRRAVPDMLHNVATETDVSLDSMLTGTKKSPGEIANTLSCL
SLSASASMSGDDNLDDDYLL
Download sequence
Identical sequences M3XWS8
ENSMPUP00000003528 ENSMPUP00000003528 XP_004776733.1.14098 XP_004776735.1.14098 XP_004776736.1.14098 XP_012903443.1.14098 XP_012903444.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]