SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003600 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003600
Domain Number 1 Region: 12-104,152-178
Classification Level Classification E-value
Superfamily SH2 domain 1.96e-28
Family SH2 domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 119-208
Classification Level Classification E-value
Superfamily SH3-domain 5.21e-21
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 3 Region: 225-300
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000538
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003600   Gene: ENSMPUG00000003629   Transcript: ENSMPUT00000003667
Sequence length 303
Comment pep:novel scaffold:MusPutFur1.0:GL896906.1:2177678:2219776:1 gene:ENSMPUG00000003629 transcript:ENSMPUT00000003667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSNTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
Download sequence
Identical sequences M3XX00
ENSMPUP00000003600 ENSMPUP00000003600 XP_004742614.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]