SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003623 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003623
Domain Number 1 Region: 48-210
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.84e-76
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003623   Gene: ENSMPUG00000003652   Transcript: ENSMPUT00000003690
Sequence length 211
Comment pep:known scaffold:MusPutFur1.0:GL897009.1:2141349:2148345:-1 gene:ENSMPUG00000003652 transcript:ENSMPUT00000003690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALRCGPRLLRLLPVPRSAPLRLPAARACSSSSSSGGGSRDSSSSSRNPLVYLDVGADG
QPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTG
GKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKE
GMDVVKKIESFGSRSGKTSKKIVITDCGQLS
Download sequence
Identical sequences M3XX23
ENSMPUP00000003623 ENSMPUP00000003623 XP_004765367.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]