SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003681 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003681
Domain Number 1 Region: 1034-1116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 1120-1207
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 739-797
Classification Level Classification E-value
Superfamily BPTI-like 2.32e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 4 Region: 893-975
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000373
Family I set domains 0.042
Further Details:      
 
Domain Number 5 Region: 305-360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000458
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 366-424
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 27-76
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000118
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 8 Region: 480-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 423-480
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003681   Gene: ENSMPUG00000003711   Transcript: ENSMPUT00000003749
Sequence length 1265
Comment pep:novel scaffold:MusPutFur1.0:GL896944.1:12523920:12551757:1 gene:ENSMPUG00000003711 transcript:ENSMPUT00000003749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLVPLLLAPAPRSWAPKVRRQSDTWGPWGPWSSCSRTCGVGISVRERPCFSQRRDG
GSSCVGSARSHRSCHTESCPEGARDFRAEQCSQFDSQDFQGRWYKWLPYYGAPDKCELNC
IPKGENFYFKHREAVVDGTPCEPGTRDVCVDGSCRVVGCDYNLDSAEEEDKCLQCGGDGR
TCYPVTGTFDANDLSRGYNQMLIIPAGATSIRMEEVAASRNFLAVKSVRGEYYLNGHWTI
GDAWALPAASTVLHYERGAEGDLAPERLYARGPTSEPLVIELLSQEPNPGVRYEYHLPLG
SSPSGFHWSHGSWSDCSAECGGGHQSRPVFCTTDNEVYPDRMCQHQLRPADRRPCSTHPC
PQTKRWKTGPWSPCSASCGGGSQSRSVYCVSSDGAGSQEATGEAECAGQPGKPPATRACN
LQRCAAWTVEPWGECSVSCGAGVRRRSVTCRSDEGSPLHAAACPAEDRPPITEPCVREDC
PPTHEQAWRVGAWGLCSKSCGAGTRRRQVICALGSPGLCGSLQLSKPREAEPCNTQPCHL
PPEVPSVEDVLAGPRDPRMSLGPQVAANPDSRGQWWLPQEQTLVPGNPSGAQGLHLPGLA
PSLPQSPHQQPLRPGLAPQDCRHSPYGCCPDGHTASLGPQWQGCPGASCQQSRYGCCPDG
VSVAEGPQHAGCAGSSSSDNTRRRPGSRAVASSAPKTHQPRAQQNEPSECRGSQFGCCYD
NVASAAGPLGEGCLGQPSYAYPVRCLLPSAHGSCVDWAARWYFVPSVGRCNRFWYGGCHG
NGNNFASEEECMSRCRGPPAGARGHGAGSGPGGQHEARWQRMGATVQTKPLPSGGVLWRD
REPGPREESHAQAFGERPWRGELGPSAPGLGGDAGRPAPPSRSSSYRVSLAGQEPSLVQA
SPGQLVQLVCQDDDASLEPHGQWQKDGQPVSSDRHKLQPDGSLVIRPLRAEDAGIYSCGG
SRQDGDSPKIQLRVIGGDVAVLSEAEPRHFPRTRDPAQGHSPWDSSLVGDRRGPGAVSSS
RPRPTTRLLLDRNQPRVVDAQPGQRARLTCRAEGFPPPTIEWQRDGQPLSSPRHQLQPDG
SLVISHVAMEDGGFYACVAFNGQDRDQRWVQLRVLGELTIEELPSTMMVPEGDTARLLCV
VTGESVNIRWSRNGLPVRADGHRVYQSPDGTLLIHNLQARDEGSYTCSAYRGSQAVSRST
DVRVVPPALPGQSGALGRECVDQPELANCDLILKAQLCGNEYYSSFCCASCSRSQPPAQP
VWQQG
Download sequence
Identical sequences M3XX81
ENSMPUP00000003681 ENSMPUP00000003681 XP_004754896.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]