SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003781 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003781
Domain Number 1 Region: 1336-1444
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-33
Family PDZ domain 0.00000446
Further Details:      
 
Domain Number 2 Region: 1742-1919
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-28
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 3 Region: 1499-1589
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-18
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 4 Region: 724-794
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-16
Family PDZ domain 0.021
Further Details:      
 
Domain Number 5 Region: 598-710
Classification Level Classification E-value
Superfamily PDZ domain-like 4.53e-16
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 6 Region: 1599-1666
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000197
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 7 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000465
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003781   Gene: ENSMPUG00000003812   Transcript: ENSMPUT00000003850
Sequence length 1922
Comment pep:novel scaffold:MusPutFur1.0:GL897009.1:3408162:3523301:1 gene:ENSMPUG00000003812 transcript:ENSMPUT00000003850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLL
LAKERDHFQDLRAALEKTQPHLLPILYLNGVVGPPQPSEGAGSTYSVLSIMPSDSESSSS
LSSVGTTGKAPSPPPLLTDRQVNEKVENLSIQLRLMTRERNELRKRLAFATHGTTFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQKQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQL
KDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIGDLRAQQQQVLKLNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNSDLSRLEQLEEENQRLLKQAETLTQQRD
TAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSEMTELRTMQAKMAKESEK
YKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAASEEMEALRQI
KDTVTLDAGRANKEAELLRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEGVNEPCLPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQALKALLHGEGAINMVVRRRKSLGGKVITPL
YINLSGQKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSIRAHGAEVQAQNKRSLLQHNN
STQTDIFYADRLEDRRELGPPGGSSSFLHKPFPGGPFPVSPQACPSASERSLSSFRSDTS
GERGYGLVDVRSRRPLLPFETEAGPCGAAEAPLDKADPEGSSSGGTWPKAVLSSTAGPEK
LSVYKKPKQRKSIFDPNTFKRPQTPSKIDYLLPGPGSAHSPQPSKRVGPLTPPKPPRRSD
SIKFQHRLETSSESEATLVGSSPSTSPPSALPPDMDPREPMHTSPPRKGRVRIASSYYPE
GDGDSSYLPAKKSCDGDLTSQKMDELGQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKSIP
ASGELCPELQEWSLYSPGHSSRHSNPPFYPGRASAGTVPRSMTPSATVSSMLRNPVYTVR
SHRVGPCSSPPVPREVGPQGLHPSAQHQGRLSLDLSHRVGSDYSDMRTSHGSNSLPSSAR
LGSSSNLQFKAERIKIPSTPRYPRSIVGSDRGSLSHSECSTPPQSPLSIDTLSSSCSQSQ
TSASTLPRIAVNPAALGERRKDRPYAEEPRHVKLQKGSEPLGISIVSGEKGGVYVSKVTG
GSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHMHQLSSHSR
SSSHLDPASTHCTLQGSSAAPPEHPSVIDPLMEQDEGPGTPPAKQSTPSSRMVGDANKKT
PEPRVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPEGLVPGDLILEYGGLDVRN
KTVEEVYVEMLKPKDGVRLKVQYRPEEFTKVKSLPGDSFYIRALYDRLAEVEHELSFKKD
DILYVDDTLPQGTFGSWMAWQLDENAQKMQRGQIPSKYVMDQEFSRRLSMSEVKDDNNAA
KTLSAAARRSFFRRKHKHKRSGSKDGKDLLALDTFSNDTIPLFEDSVSLAYQRVQKVDCT
SLRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGH
FDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYL
KDKVTQRHSKEQFETAQKIEQEYSRYFTGVVQGGALSSICTQILAMVNQEQSKVLWIPAC
PL
Download sequence
Identical sequences M3XXI1
XP_004765377.1.14098 ENSMPUP00000003781 ENSMPUP00000003781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]